SCOPe 2.08: Domain d5m3va2: 5m3v A:340-444

Lineage for d5m3va2 (5m3v A:340-444)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5m3va2: 5m3v A:340-444 [334182]
   Other proteins in same PDB: d5m3va1, d5m3vb1, d5m3vb2
   automated match to d1hzhh4

Details for d5m3va2

PDB Entry: 5m3v, 1.97 Å

PDB Description: beat fc

PDB Compounds: (A:) Ig gamma-1 chain C region,Ig gamma-3 chain C region

SCOPe Domain Sequences for d5m3va2:

Sequence; same for both SEQRES and ATOM records:

>d5m3va2 b.1.1.0 (A:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvklvclvtgfypsdiavewessgqpennyyttppmld
sdgsfslvswlnvdksrwqqgnifscsvmhealhnrftqkslsls

Timeline for d5m3va2:

• d5m3va2 first appeared in SCOPe 2.06
  
• d5m3va2 appears in SCOPe 2.07