SCOPe 2.06: Domain d3mg4d_: 3mg4 D:

Lineage for d3mg4d_ (3mg4 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (14 PDB entries)

8. Domain d3mg4d_: 3mg4 D: [334173]
   automated match to d1iruf_
   complexed with lxt, mes, mg

Details for d3mg4d_

PDB Entry: 3mg4, 3.11 Å

PDB Description: structure of yeast 20s proteasome with compound 1

PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3mg4d_:

Sequence; same for both SEQRES and ATOM records:

>d3mg4d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Timeline for d3mg4d_:

• d3mg4d_ is new in SCOPe 2.06-stable
  
• d3mg4d_ appears in SCOPe 2.07
  
• d3mg4d_ appears in the current release, SCOPe 2.08