Lineage for d3mg4d_ (3mg4 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (15 species)
    not a true protein
  7. 2554848Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2554881Domain d3mg4d_: 3mg4 D: [334173]
    Other proteins in same PDB: d3mg41_, d3mg42_, d3mg4a_, d3mg4b_, d3mg4c_, d3mg4e_, d3mg4f_, d3mg4g_, d3mg4h_, d3mg4i_, d3mg4j_, d3mg4k_, d3mg4l_, d3mg4m_, d3mg4n_, d3mg4o_, d3mg4p_, d3mg4q_, d3mg4s_, d3mg4t_, d3mg4u_, d3mg4v_, d3mg4w_, d3mg4x_, d3mg4y_, d3mg4z_
    automated match to d1iruf_
    complexed with lxt, mes, mg

Details for d3mg4d_

PDB Entry: 3mg4 (more details), 3.11 Å

PDB Description: structure of yeast 20s proteasome with compound 1
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3mg4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg4d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3mg4d_:

Click to download the PDB-style file with coordinates for d3mg4d_.
(The format of our PDB-style files is described here.)

Timeline for d3mg4d_: