Lineage for d5j77c_ (5j77 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2157920Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2157921Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2158358Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2158359Protein automated matches [190683] (49 species)
    not a true protein
  7. 2159181Species Thermoplasma acidophilum [TaxId:273075] [334133] (1 PDB entry)
  8. 2159184Domain d5j77c_: 5j77 C: [334142]
    automated match to d4pz2a_
    mutant

Details for d5j77c_

PDB Entry: 5j77 (more details), 2.1 Å

PDB Description: mutant glyceraldehyde dehydrogenase (f34m+s405n) from thermoplasma acidophilum
PDB Compounds: (C:) D-glyceraldehyde dehydrogenase (NADP(+))

SCOPe Domain Sequences for d5j77c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j77c_ c.82.1.0 (C:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
plhintvrddlf

SCOPe Domain Coordinates for d5j77c_:

Click to download the PDB-style file with coordinates for d5j77c_.
(The format of our PDB-style files is described here.)

Timeline for d5j77c_: