Lineage for d5kija_ (5kij A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722400Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2722401Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2722402Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2722417Species Human (Homo sapiens) [TaxId:9606] [48229] (6 PDB entries)
  8. 2722419Domain d5kija_: 5kij A: [334109]
    automated match to d1fo2a_
    complexed with 1ps, bu1, la, so4

Details for d5kija_

PDB Entry: 5kij (more details), 1.65 Å

PDB Description: crystal structure of the class i human endoplasmic reticulum 1,2- alpha-mannosidase and man9glcnac2-pa complex
PDB Compounds: (A:) Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

SCOPe Domain Sequences for d5kija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kija_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddpnllsldayvfnteahplpiw

SCOPe Domain Coordinates for d5kija_:

Click to download the PDB-style file with coordinates for d5kija_.
(The format of our PDB-style files is described here.)

Timeline for d5kija_: