SCOPe 2.08: Domain d5kk7b_: 5kk7 B:

Lineage for d5kk7b_ (5kk7 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family)
   automatically mapped to Pfam PF01532

5. Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)

6. Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48229] (6 PDB entries)

8. Domain d5kk7b_: 5kk7 B: [334097]
   automated match to d1fo2a_
   complexed with 1ps, act, bu1, ca, so4; mutant

Details for d5kk7b_

PDB Entry: 5kk7, 1.73 Å

PDB Description: crystal structure of the class i human endoplasmic reticulum 1,2- alpha-mannosidase t688a mutant and thio-disaccharide substrate analog complex

PDB Compounds: (B:) Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

SCOPe Domain Sequences for d5kk7b_:

Sequence; same for both SEQRES and ATOM records:

>d5kk7b_ a.102.2.1 (B:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddpnllsldayvfnaeahplpiwtpa

Timeline for d5kk7b_:

• d5kk7b_ first appeared in SCOPe 2.06
  
• d5kk7b_ appears in SCOPe 2.07