Lineage for d5vh5a1 (5vh5 A:241-342)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) 
Domain d5vh5a1: 5vh5 A:241-342 [334063]
automated match to d1hzhk3
complexed with act, zn
Details for d5vh5a1
PDB Entry: 5vh5 (more details), 1.75 Å
PDB Description: crystal structure of fc fragment of anti-tnfa antibody infliximab
PDB Compounds: (A:) Infliximab FcSCOPe Domain Sequences for d5vh5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vh5a1 b.1.1.2 (A:241-342) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
SCOPe Domain Coordinates for d5vh5a1:
Click to download the PDB-style file with coordinates for d5vh5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5vh5a1:
- d5vh5a1 first appeared in SCOPe 2.06
- d5vh5a1 appears in SCOPe 2.07
View in 3D
