Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (16 species) not a true protein |
Species Naegleria fowleri [TaxId:5763] [334024] (1 PDB entry) |
Domain d5vjye1: 5vjy E:2-131 [334056] Other proteins in same PDB: d5vjya2, d5vjyb2, d5vjyc2, d5vjyd2, d5vjye2 automated match to d4oopb_ complexed with btb, edo |
PDB Entry: 5vjy (more details), 2 Å
SCOPe Domain Sequences for d5vjye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vjye1 b.85.4.0 (E:2-131) automated matches {Naegleria fowleri [TaxId: 5763]} stpqlmrvkklsefailpvrssqfaagfdlasaydyvvpargkclvktdlavavphgyyg rvaprsglavknfidvgagvvdsdyrgnlgvllfnhgdedfkiargdriaqfvieqialp divevddlde
Timeline for d5vjye1: