Lineage for d5vj5a2 (5vj5 A:164-339)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841027Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2841044Species Horse (Equus caballus) [TaxId:9796] [51738] (53 PDB entries)
    Uniprot P00327
  8. 2841128Domain d5vj5a2: 5vj5 A:164-339 [334049]
    Other proteins in same PDB: d5vj5a1, d5vj5b1
    automated match to d1heta2
    complexed with phn, zn

Details for d5vj5a2

PDB Entry: 5vj5 (more details), 1.9 Å

PDB Description: horse liver alcohol dehydrogenase complexed with 1,10-phenanthroline
PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d5vj5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vj5a2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d5vj5a2:

Click to download the PDB-style file with coordinates for d5vj5a2.
(The format of our PDB-style files is described here.)

Timeline for d5vj5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vj5a1