Lineage for d5v4md1 (5v4m D:4-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938724Domain d5v4md1: 5v4m D:4-81 [334043]
    Other proteins in same PDB: d5v4ma2, d5v4md2, d5v4mg2, d5v4mj2
    automated match to d1fnga2
    complexed with nag

Details for d5v4md1

PDB Entry: 5v4m (more details), 2.1 Å

PDB Description: structure of hla-dr15 with bound alpha3(135-145) peptide
PDB Compounds: (D:) hla-dra1

SCOPe Domain Sequences for d5v4md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v4md1 d.19.1.0 (D:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d5v4md1:

Click to download the PDB-style file with coordinates for d5v4md1.
(The format of our PDB-style files is described here.)

Timeline for d5v4md1: