Lineage for d5vjya1 (5vjy A:2-130)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083499Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2083500Protein automated matches [191182] (16 species)
    not a true protein
  7. 2083672Species Naegleria fowleri [TaxId:5763] [334024] (1 PDB entry)
  8. 2083673Domain d5vjya1: 5vjy A:2-130 [334031]
    Other proteins in same PDB: d5vjya2, d5vjyb2, d5vjyc2, d5vjyd2, d5vjye2
    automated match to d4oopb_
    complexed with btb, edo

Details for d5vjya1

PDB Entry: 5vjy (more details), 2 Å

PDB Description: crystal structure of dutp pyrophosphatase protein, from naegleria fowleri
PDB Compounds: (A:) dUTP pyrophosphatase

SCOPe Domain Sequences for d5vjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjya1 b.85.4.0 (A:2-130) automated matches {Naegleria fowleri [TaxId: 5763]}
stpqlmrvkklsefailpvrssqfaagfdlasaydyvvpargkclvktdlavavphgyyg
rvaprsglavknfidvgagvvdsdyrgnlgvllfnhgdedfkiargdriaqfvieqialp
divevddld

SCOPe Domain Coordinates for d5vjya1:

Click to download the PDB-style file with coordinates for d5vjya1.
(The format of our PDB-style files is described here.)

Timeline for d5vjya1: