Lineage for d5vigz_ (5vig Z:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038954Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2038998Protein automated matches [190183] (7 species)
    not a true protein
  7. 2039018Species Zika virus [TaxId:64320] [320471] (5 PDB entries)
  8. 2039024Domain d5vigz_: 5vig Z: [334012]
    Other proteins in same PDB: d5vigb1, d5vigb2, d5vigl1, d5vigl2
    automated match to d1s6na_
    complexed with flc

Details for d5vigz_

PDB Entry: 5vig (more details), 3 Å

PDB Description: crystal structure of anti-zika antibody z006 bound to zika virus envelope protein diii
PDB Compounds: (Z:) Zika virus envelope protein DIII

SCOPe Domain Sequences for d5vigz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vigz_ b.1.18.4 (Z:) automated matches {Zika virus [TaxId: 64320]}
yslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpv
itestenskmmleldppfgdsyivigvgekkithhwhrsg

SCOPe Domain Coordinates for d5vigz_:

Click to download the PDB-style file with coordinates for d5vigz_.
(The format of our PDB-style files is described here.)

Timeline for d5vigz_: