SCOPe 2.08: Domain d5vh3l1: 5vh3 L:1-106

Lineage for d5vh3l1 (5vh3 L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5vh3l1: 5vh3 L:1-106 [334006]
   Other proteins in same PDB: d5vh3a_, d5vh3b2, d5vh3h_, d5vh3l2
   automated match to d1dn0a1
   complexed with edo

Details for d5vh3l1

PDB Entry: 5vh3, 2 Å

PDB Description: crystal structure of fab fragment of the anti-tnfa antibody infliximab in a c-centered orthorhombic crystal form

PDB Compounds: (L:) Infliximab Fab Light Chain

SCOPe Domain Sequences for d5vh3l1:

Sequence; same for both SEQRES and ATOM records:

>d5vh3l1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspailsvspgervsfscrasqfvgssihwyqqrtngsprllikyasesmsgips
rfsgsgsgtdftlsintvesediadyycqqshswpftfgsgtnlev

Timeline for d5vh3l1:

• d5vh3l1 first appeared in SCOPe 2.06
  
• d5vh3l1 appears in SCOPe 2.07