Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d5vh3l1: 5vh3 L:1-106 [334006] Other proteins in same PDB: d5vh3a_, d5vh3b2, d5vh3h_, d5vh3l2 automated match to d1dn0a1 complexed with edo |
PDB Entry: 5vh3 (more details), 2 Å
SCOPe Domain Sequences for d5vh3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vh3l1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilltqspailsvspgervsfscrasqfvgssihwyqqrtngsprllikyasesmsgips rfsgsgsgtdftlsintvesediadyycqqshswpftfgsgtnlev
Timeline for d5vh3l1:
View in 3D Domains from other chains: (mouse over for more information) d5vh3a_, d5vh3b1, d5vh3b2, d5vh3h_ |