Lineage for d5vigl2 (5vig L:107-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030506Domain d5vigl2: 5vig L:107-213 [334003]
    Other proteins in same PDB: d5vigb1, d5vigg_, d5vigl1, d5vigz_
    automated match to d1dn0a2
    complexed with flc

Details for d5vigl2

PDB Entry: 5vig (more details), 3 Å

PDB Description: crystal structure of anti-zika antibody z006 bound to zika virus envelope protein diii
PDB Compounds: (L:) Fab heavy chain

SCOPe Domain Sequences for d5vigl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vigl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5vigl2:

Click to download the PDB-style file with coordinates for d5vigl2.
(The format of our PDB-style files is described here.)

Timeline for d5vigl2: