SCOPe 2.06: Domain d5vigl2: 5vig L:107-213

Lineage for d5vigl2 (5vig L:107-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5vigl2: 5vig L:107-213 [334003]
   Other proteins in same PDB: d5vigb1, d5vigg_, d5vigl1, d5vigz_
   automated match to d1dn0a2
   complexed with flc

Details for d5vigl2

PDB Entry: 5vig, 3 Å

PDB Description: crystal structure of anti-zika antibody z006 bound to zika virus envelope protein diii

PDB Compounds: (L:) Fab heavy chain

SCOPe Domain Sequences for d5vigl2:

Sequence; same for both SEQRES and ATOM records:

>d5vigl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5vigl2:

• d5vigl2 is new in SCOPe 2.06-stable
  
• d5vigl2 appears in SCOPe 2.07
  
• d5vigl2 appears in the current release, SCOPe 2.08