Lineage for d5vice_ (5vic E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039599Species Dengue virus type 1 (strain nauru/west pac/1974) [TaxId:11059] [334000] (1 PDB entry)
  8. 2039600Domain d5vice_: 5vic E: [334001]
    Other proteins in same PDB: d5vicl1, d5vicl2
    automated match to d3egpa_

Details for d5vice_

PDB Entry: 5vic (more details), 3 Å

PDB Description: crystal structure of anti-zika antibody z004 bound to denv-1 envelope protein diii
PDB Compounds: (E:) Dengue 1 Envelope DIII domain

SCOPe Domain Sequences for d5vice_:

Sequence, based on SEQRES records: (download)

>d5vice_ b.1.18.0 (E:) automated matches {Dengue virus type 1 (strain nauru/west pac/1974) [TaxId: 11059]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswf

Sequence, based on observed residues (ATOM records): (download)

>d5vice_ b.1.18.0 (E:) automated matches {Dengue virus type 1 (strain nauru/west pac/1974) [TaxId: 11059]}
syvmctgsfklekevaegtvlvqvkyegtdapckipfssqngrlitanpivtdkekpvni
eaeppesyivvgagekalklswf

SCOPe Domain Coordinates for d5vice_:

Click to download the PDB-style file with coordinates for d5vice_.
(The format of our PDB-style files is described here.)

Timeline for d5vice_: