Lineage for d5vigb1 (5vig B:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034285Domain d5vigb1: 5vig B:1-106 [333978]
    Other proteins in same PDB: d5vigb2, d5vigg_, d5vigl2, d5vigz_
    automated match to d1dn0a1
    complexed with flc

Details for d5vigb1

PDB Entry: 5vig (more details), 3 Å

PDB Description: crystal structure of anti-zika antibody z006 bound to zika virus envelope protein diii
PDB Compounds: (B:) Fab heavy chain

SCOPe Domain Sequences for d5vigb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vigb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtmtcrasqtisgwlawyqqkpgkapklliyqasrlesgips
rfsgsgsgteftltisslqpddvatyycqqystfwtfglgtkvei

SCOPe Domain Coordinates for d5vigb1:

Click to download the PDB-style file with coordinates for d5vigb1.
(The format of our PDB-style files is described here.)

Timeline for d5vigb1: