Lineage for d5v4mg2 (5v4m G:82-181)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 2356255Domain d5v4mg2: 5v4m G:82-181 [333943]
    Other proteins in same PDB: d5v4ma1, d5v4md1, d5v4mg1, d5v4mj1
    automated match to d1ieaa1
    complexed with fuc, nag

Details for d5v4mg2

PDB Entry: 5v4m (more details), 2.1 Å

PDB Description: structure of hla-dr15 with bound alpha3(135-145) peptide
PDB Compounds: (G:) hla-dra1

SCOPe Domain Sequences for d5v4mg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v4mg2 b.1.1.0 (G:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d5v4mg2:

Click to download the PDB-style file with coordinates for d5v4mg2.
(The format of our PDB-style files is described here.)

Timeline for d5v4mg2: