Lineage for d5vl0a1 (5vl0 A:1-163,A:340-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785523Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
    Uniprot P00327
  8. 2785554Domain d5vl0a1: 5vl0 A:1-163,A:340-374 [333927]
    Other proteins in same PDB: d5vl0a2, d5vl0b2, d5vl0c2, d5vl0d2
    automated match to d1heta1
    complexed with bnf, mrd, nai, zn

Details for d5vl0a1

PDB Entry: 5vl0 (more details), 1.2 Å

PDB Description: horse liver alcohol dehydrogenase complexed with nadh and n- benzyformamide
PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d5vl0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vl0a1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d5vl0a1:

Click to download the PDB-style file with coordinates for d5vl0a1.
(The format of our PDB-style files is described here.)

Timeline for d5vl0a1: