SCOPe 2.06: Domain d5ujbb3: 5ujb B:389-568

Lineage for d5ujbb3 (5ujb B:389-568)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
   Uniprot P02768 29-596

8. Domain d5ujbb3: 5ujb B:389-568 [333899]
   automated match to d1n5ua3
   complexed with 6ak, po4

Details for d5ujbb3

PDB Entry: 5ujb, 2.7 Å

PDB Description: structure of a mcl-1 inhibitor binding to site 3 of human serum albumin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d5ujbb3:

Sequence; same for both SEQRES and ATOM records:

>d5ujbb3 a.126.1.1 (B:389-568) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf

Timeline for d5ujbb3:

• d5ujbb3 is new in SCOPe 2.06-stable
  
• d5ujbb3 appears in SCOPe 2.07
  
• d5ujbb3 appears in the current release, SCOPe 2.08