Lineage for d5hbvb1 (5hbv B:2-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408949Species Mouse (Mus musculus) [TaxId:10090] [194495] (2 PDB entries)
  8. 2408951Domain d5hbvb1: 5hbv B:2-211 [333894]
    Other proteins in same PDB: d5hbva_, d5hbvb2, d5hbvc1, d5hbvc2
    automated match to d4uxua_
    complexed with bma, man, nag

Details for d5hbvb1

PDB Entry: 5hbv (more details), 2.7 Å

PDB Description: complex structure of fab35 and mouse nachr alpha1
PDB Compounds: (B:) Acetylcholine receptor subunit alpha 1

SCOPe Domain Sequences for d5hbvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbvb1 b.96.1.0 (B:2-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehetrleaklfedyssvvrpvedhreivqvtvglqliqlinvdevnqivttnvrlkqqwv
dynlkwnpddyggvkkihipsekiwrpdvvlynnadgdfaivkftkvlldytghitwtpp
aifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvikea
rgwkhwvfysccpttpyldityhfvmqrlp

SCOPe Domain Coordinates for d5hbvb1:

Click to download the PDB-style file with coordinates for d5hbvb1.
(The format of our PDB-style files is described here.)

Timeline for d5hbvb1: