SCOPe 2.06: Domain d5tl7d2: 5tl7 D:63-316

Lineage for d5tl7d2 (5tl7 D:63-316)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (5 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries)

8. Domain d5tl7d2: 5tl7 D:63-316 [333892]
   Other proteins in same PDB: d5tl7a_, d5tl7b1, d5tl7b3, d5tl7c_, d5tl7d1
   automated match to d2fe8a2
   complexed with zn

Details for d5tl7d2

PDB Entry: 5tl7, 2.44 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with c- terminal domain mouse isg15

PDB Compounds: (D:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d5tl7d2:

Sequence; same for both SEQRES and ATOM records:

>d5tl7d2 d.3.1.23 (D:63-316) automated matches {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttik

Timeline for d5tl7d2:

• d5tl7d2 is new in SCOPe 2.06-stable
  
• d5tl7d2 appears in SCOPe 2.07
  
• d5tl7d2 appears in the current release, SCOPe 2.08