Lineage for d5tl7b2 (5tl7 B:63-316)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498013Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2498033Protein automated matches [310868] (5 species)
    not a true protein
  7. 2498042Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries)
  8. 2498045Domain d5tl7b2: 5tl7 B:63-316 [333881]
    Other proteins in same PDB: d5tl7a_, d5tl7b1, d5tl7b3, d5tl7c_, d5tl7d1
    automated match to d2fe8a2
    complexed with zn

Details for d5tl7b2

PDB Entry: 5tl7 (more details), 2.44 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with c- terminal domain mouse isg15
PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d5tl7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl7b2 d.3.1.23 (B:63-316) automated matches {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttik

SCOPe Domain Coordinates for d5tl7b2:

Click to download the PDB-style file with coordinates for d5tl7b2.
(The format of our PDB-style files is described here.)

Timeline for d5tl7b2: