Lineage for d1ba1_2 (1ba1 189-381)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries) 
Domain d1ba1_2: 1ba1 189-381 [33388]
Details for d1ba1_2
PDB Entry: 1ba1 (more details), 1.7 Å
PDB Description: heat-shock cognate 70kd protein 44kd atpase n-terminal mutant with cys 17 replaced by lys
SCOP Domain Sequences for d1ba1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ba1_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
SCOP Domain Coordinates for d1ba1_2:
Click to download the PDB-style file with coordinates for d1ba1_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ba1_2:
- d1ba1_2 appears in SCOP 1.57
- d1ba1_2 appears in the current release, SCOPe 2.08, called d1ba1a2
View in 3D
