SCOPe 2.07: Domain d5hbvc2: 5hbv C:107-211

Lineage for d5hbvc2 (5hbv C:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)

8. Domain d5hbvc2: 5hbv C:107-211 [333854]
   Other proteins in same PDB: d5hbva_, d5hbvb1, d5hbvb2, d5hbvc1
   automated match to d1c5da2
   complexed with bma, man, nag

Details for d5hbvc2

PDB Entry: 5hbv, 2.7 Å

PDB Description: complex structure of fab35 and mouse nachr alpha1

PDB Compounds: (C:) Fab35, Light Chain

SCOPe Domain Sequences for d5hbvc2:

Sequence; same for both SEQRES and ATOM records:

>d5hbvc2 b.1.1.2 (C:107-211) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrn

Timeline for d5hbvc2:

• d5hbvc2 first appeared in SCOPe 2.06
  
• d5hbvc2 appears in the current release, SCOPe 2.08