Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries) |
Domain d5hbvc2: 5hbv C:107-211 [333854] Other proteins in same PDB: d5hbva_, d5hbvb1, d5hbvb2, d5hbvc1 automated match to d1c5da2 complexed with bma, man, nag |
PDB Entry: 5hbv (more details), 2.7 Å
SCOPe Domain Sequences for d5hbvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hbvc2 b.1.1.2 (C:107-211) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrn
Timeline for d5hbvc2: