Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (8 PDB entries) |
Domain d5hbvc1: 5hbv C:1-106 [333853] Other proteins in same PDB: d5hbva_, d5hbvb1, d5hbvb2, d5hbvc2 automated match to d1c5da1 complexed with bma, man, nag |
PDB Entry: 5hbv (more details), 2.7 Å
SCOPe Domain Sequences for d5hbvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hbvc1 b.1.1.0 (C:1-106) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelk
Timeline for d5hbvc1: