Lineage for d5hbvc1 (5hbv C:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2035535Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (8 PDB entries)
  8. 2035563Domain d5hbvc1: 5hbv C:1-106 [333853]
    Other proteins in same PDB: d5hbva_, d5hbvb1, d5hbvb2, d5hbvc2
    automated match to d1c5da1
    complexed with bma, man, nag

Details for d5hbvc1

PDB Entry: 5hbv (more details), 2.7 Å

PDB Description: complex structure of fab35 and mouse nachr alpha1
PDB Compounds: (C:) Fab35, Light Chain

SCOPe Domain Sequences for d5hbvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbvc1 b.1.1.0 (C:1-106) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelk

SCOPe Domain Coordinates for d5hbvc1:

Click to download the PDB-style file with coordinates for d5hbvc1.
(The format of our PDB-style files is described here.)

Timeline for d5hbvc1: