Lineage for d5nqha_ (5nqh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803912Domain d5nqha_: 5nqh A: [333851]
    automated match to d3dxda_
    complexed with gol, so4

Details for d5nqha_

PDB Entry: 5nqh (more details), 2.6 Å

PDB Description: structure of the human fe65-ptb2 homodimer
PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family B member 1

SCOPe Domain Sequences for d5nqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqha_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqte
avlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlry
qkcldars

SCOPe Domain Coordinates for d5nqha_:

Click to download the PDB-style file with coordinates for d5nqha_.
(The format of our PDB-style files is described here.)

Timeline for d5nqha_: