Lineage for d5tl6c_ (5tl6 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (82 PDB entries)
  8. 2502726Domain d5tl6c_: 5tl6 C: [333845]
    Other proteins in same PDB: d5tl6b2, d5tl6d2
    automated match to d3phxb_
    complexed with so4, zn

Details for d5tl6c_

PDB Entry: 5tl6 (more details), 2.62 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5tl6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl6c_ d.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
eyglkplstvfmnlrlrgx

SCOPe Domain Coordinates for d5tl6c_:

Click to download the PDB-style file with coordinates for d5tl6c_.
(The format of our PDB-style files is described here.)

Timeline for d5tl6c_: