SCOPe 2.08: Domain d5tl6b2: 5tl6 B:63-316

Lineage for d5tl6b2 (5tl6 B:63-316)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Human sars coronavirus [TaxId:227859] [333837] (3 PDB entries)

8. Domain d5tl6b2: 5tl6 B:63-316 [333841]
   Other proteins in same PDB: d5tl6a_, d5tl6b1, d5tl6c_, d5tl6d1
   automated match to d2fe8a2
   complexed with so4, zn

Details for d5tl6b2

PDB Entry: 5tl6, 2.62 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with the c-terminal domain of human isg15

PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d5tl6b2:

Sequence; same for both SEQRES and ATOM records:

>d5tl6b2 d.3.1.23 (B:63-316) automated matches {Human sars coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttik

Timeline for d5tl6b2:

• d5tl6b2 first appeared in SCOPe 2.06
  
• d5tl6b2 appears in SCOPe 2.07