Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (31 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [324924] (4 PDB entries) |
Domain d5jgyb_: 5jgy B: [333796] automated match to d2bgqa_ complexed with 6kb, edo |
PDB Entry: 5jgy (more details), 1.45 Å
SCOPe Domain Sequences for d5jgyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jgyb_ c.1.7.0 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]} gerghfvlksghtipavglgtwragsdtahsvrtaiaeagyrhvdtaaqygvekevgrgl kaamegginrkdlfvtsklwctelapdrvrpalektlkdlqldyldlylihwpfrlkdga hmppeagevleldmegvwremeglvkdglvkdigvcnytvaklnrlmrsanvppavcqme mhpgwkndrifeackkhgihvtaysplgsseknlahdplvekvankldktpgqvllrwal qrgtsvipkstrderikeniqvfgweipeedfralcgikdekrvltgeelfvnkthgpyk satevwdhed
Timeline for d5jgyb_: