Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Cytokine receptor common gamma chain [141041] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries) Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141 |
Domain d5m5ec2: 5m5e C:130-225 [333779] Other proteins in same PDB: d5m5eb1, d5m5eb2, d5m5ed_ automated match to d2erjc2 complexed with cys, man, nag, so4 |
PDB Entry: 5m5e (more details), 2.3 Å
SCOPe Domain Sequences for d5m5ec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m5ec2 b.1.2.1 (C:130-225) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp svdgqkrytfrvrsrfnplcgsaqhwsewshpihwg
Timeline for d5m5ec2: