Lineage for d5jotb_ (5jot B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164148Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (6 PDB entries)
  8. 2164175Domain d5jotb_: 5jot B: [333750]
    automated match to d3kbra_
    complexed with act

Details for d5jotb_

PDB Entry: 5jot (more details), 3.11 Å

PDB Description: low-resolution structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa in space group p4322.
PDB Compounds: (B:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5jotb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jotb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
pelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwleyrwptah

SCOPe Domain Coordinates for d5jotb_:

Click to download the PDB-style file with coordinates for d5jotb_.
(The format of our PDB-style files is described here.)

Timeline for d5jotb_:

  • d5jotb_ is new in SCOPe 2.06-stable
  • d5jotb_ does not appear in SCOPe 2.07