Lineage for d5jlyc_ (5jly C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880263Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries)
  8. 2880278Domain d5jlyc_: 5jly C: [333740]
    automated match to d3ztlb_

Details for d5jlyc_

PDB Entry: 5jly (more details), 3.05 Å

PDB Description: structure of peroxiredoxin-1 from schistosoma japonicum
PDB Compounds: (C:) Thioredoxin peroxidase-1

SCOPe Domain Sequences for d5jlyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jlyc_ c.47.1.0 (C:) automated matches {Schistosoma japonicum [TaxId: 6182]}
mvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiiafsdevd
qfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygvldeeeg
nafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekyg

SCOPe Domain Coordinates for d5jlyc_:

Click to download the PDB-style file with coordinates for d5jlyc_.
(The format of our PDB-style files is described here.)

Timeline for d5jlyc_: