Lineage for d5jgwa_ (5jgw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829673Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2829674Protein automated matches [190793] (31 species)
    not a true protein
  7. 2829761Species Maize (Zea mays) [TaxId:4577] [324924] (4 PDB entries)
  8. 2829766Domain d5jgwa_: 5jgw A: [333720]
    automated match to d2bgqa_
    complexed with act, nap

Details for d5jgwa_

PDB Entry: 5jgw (more details), 2.3 Å

PDB Description: crystal structure of maize akr4c13 in complex with nadp and acetate
PDB Compounds: (A:) Aldose reductase, AKR4C13

SCOPe Domain Sequences for d5jgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jgwa_ c.1.7.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]}
avgqgerghfvlksghtipavglgtwragsdtahsvrtaiaeagyrhvdtaaqygvekev
grglkaamegginrkdlfvtsklwctelapdrvrpalektlkdlqldyldlylihwpfrl
kdgahmppeagevleldmegvwremeglvkdglvkdigvcnytvaklnrlmrsanvppav
cqmemhpgwkndrifeackkhgihvtaysplgsseknlahdplvekvankldktpgqvll
rwalqrgtsvipkstrderikeniqvfgweipeedfralcgikdekrvltgeelfvnkth
gpyksatevwdhed

SCOPe Domain Coordinates for d5jgwa_:

Click to download the PDB-style file with coordinates for d5jgwa_.
(The format of our PDB-style files is described here.)

Timeline for d5jgwa_: