Lineage for d5hbtc1 (5hbt C:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2035535Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (8 PDB entries)
  8. 2035562Domain d5hbtc1: 5hbt C:1-106 [333717]
    Other proteins in same PDB: d5hbta_, d5hbtb1, d5hbtb2, d5hbtc2
    automated match to d1c5da1
    complexed with bma, man, nag

Details for d5hbtc1

PDB Entry: 5hbt (more details), 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1
PDB Compounds: (C:) Fab35, Light Chain

SCOPe Domain Sequences for d5hbtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbtc1 b.1.1.0 (C:1-106) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelk

SCOPe Domain Coordinates for d5hbtc1:

Click to download the PDB-style file with coordinates for d5hbtc1.
(The format of our PDB-style files is described here.)

Timeline for d5hbtc1: