Lineage for d5hbta_ (5hbt A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583549Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2583580Protein Bungarotoxin [57324] (4 species)
  7. 2583581Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 2583585Domain d5hbta_: 5hbt A: [333707]
    Other proteins in same PDB: d5hbtb1, d5hbtb2, d5hbtc1, d5hbtc2
    automated match to d1hc9a_
    complexed with bma, man, nag

Details for d5hbta_

PDB Entry: 5hbt (more details), 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1
PDB Compounds: (A:) alpha-bungarotoxin isoform v31

SCOPe Domain Sequences for d5hbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbta_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOPe Domain Coordinates for d5hbta_:

Click to download the PDB-style file with coordinates for d5hbta_.
(The format of our PDB-style files is described here.)

Timeline for d5hbta_: