SCOPe 2.06: Domain d5b7xa1: 5b7x A:1-150

Lineage for d5b7xa1 (5b7x A:1-150)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:885315] [333695] (1 PDB entry)

8. Domain d5b7xa1: 5b7x A:1-150 [333696]
   Other proteins in same PDB: d5b7xa2
   automated match to d2otgc_
   complexed with ca

Details for d5b7xa1

PDB Entry: 5b7x

PDB Description: nmr solution structure of an ef-hand calcium binding protein (ehcabp6) from entamoeba histolytica

PDB Compounds: (A:) Calmodulin, putative

SCOPe Domain Sequences for d5b7xa1:

Sequence; same for both SEQRES and ATOM records:

>d5b7xa1 a.39.1.0 (A:1-150) automated matches {Entamoeba histolytica [TaxId: 885315]}
msmeieapnantqkirdcfnfydrdydgkidvkqlgtlirslgcaptedevnsyikefai
egetfqieqfelimereqskpdtreiklrkafevfdqdkdgkikasdlahnlttvgdkmt
keevekvfsilgitmesdidlatflklval

Timeline for d5b7xa1:

• d5b7xa1 is new in SCOPe 2.06-stable
  
• d5b7xa1 appears in SCOPe 2.07
  
• d5b7xa1 appears in the current release, SCOPe 2.08