Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (30 species) not a true protein |
Species Entamoeba histolytica [TaxId:885315] [333695] (1 PDB entry) |
Domain d5b7xa1: 5b7x A:1-150 [333696] Other proteins in same PDB: d5b7xa2 automated match to d2otgc_ complexed with ca |
PDB Entry: 5b7x (more details)
SCOPe Domain Sequences for d5b7xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b7xa1 a.39.1.0 (A:1-150) automated matches {Entamoeba histolytica [TaxId: 885315]} msmeieapnantqkirdcfnfydrdydgkidvkqlgtlirslgcaptedevnsyikefai egetfqieqfelimereqskpdtreiklrkafevfdqdkdgkikasdlahnlttvgdkmt keevekvfsilgitmesdidlatflklval
Timeline for d5b7xa1: