Lineage for d5lait_ (5lai T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994140Domain d5lait_: 5lai T: [333692]
    Other proteins in same PDB: d5laia_, d5laic1, d5laic2, d5laid_, d5laie_, d5laig_, d5laii_, d5laij_, d5laik_, d5lail_, d5laio_, d5laiq1, d5laiq2, d5lair_, d5lais_, d5laiu_, d5laiw_, d5laix_, d5laiy_, d5laiz_
    automated match to d4g4sg_
    complexed with 3k4, mg

Details for d5lait_

PDB Entry: 5lai (more details), 2.5 Å

PDB Description: ligand-induced aziridine-formation at the yeast proteasomal subunit beta5 by sulfonate esters
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5lait_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lait_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5lait_:

Click to download the PDB-style file with coordinates for d5lait_.
(The format of our PDB-style files is described here.)

Timeline for d5lait_: