Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5lait_: 5lai T: [333692] Other proteins in same PDB: d5laia_, d5laic1, d5laic2, d5laid_, d5laie_, d5laig_, d5laii_, d5laij_, d5laik_, d5lail_, d5laio_, d5laiq1, d5laiq2, d5lair_, d5lais_, d5laiu_, d5laiw_, d5laix_, d5laiy_, d5laiz_ automated match to d4g4sg_ complexed with 3k4, mg |
PDB Entry: 5lai (more details), 2.5 Å
SCOPe Domain Sequences for d5lait_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lait_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d5lait_:
View in 3D Domains from other chains: (mouse over for more information) d5laia_, d5laib_, d5laic1, d5laic2, d5laid_, d5laie_, d5laif_, d5laig_, d5laih_, d5laii_, d5laij_, d5laik_, d5lail_, d5laim_, d5lain_, d5laio_, d5laip_, d5laiq1, d5laiq2, d5lair_, d5lais_, d5laiu_, d5laiv_, d5laiw_, d5laix_, d5laiy_, d5laiz_ |