SCOPe 2.08: Domain d5vcne2: 5vcn E:107-210

Lineage for d5vcne2 (5vcn E:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5vcne2: 5vcn E:107-210 [333642]
   Other proteins in same PDB: d5vcnc1, d5vcne1
   automated match to d2v7ha2
   complexed with ca, edo, nag, po4

Details for d5vcne2

PDB Entry: 5vcn, 3 Å

PDB Description: the crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8

PDB Compounds: (E:) light chain of Fab fragment of mAb 5H8

SCOPe Domain Sequences for d5vcne2:

Sequence; same for both SEQRES and ATOM records:

>d5vcne2 b.1.1.2 (E:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d5vcne2:

• d5vcne2 first appeared in SCOPe 2.06
  
• d5vcne2 appears in SCOPe 2.07