SCOP 1.63: Domain d1b43b2: 1b43 B:1-219

Lineage for d1b43b2 (1b43 B:1-219)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)

5. Family c.53.1.2: 5' to 3' exonuclease [53045] (4 proteins)
   contains additional strand and alpha-helical arch; strand order 321456; strand 6 is antiparallel to the rest

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (3 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [53055] (1 PDB entry)

8. Domain d1b43b2: 1b43 B:1-219 [33363]
   Other proteins in same PDB: d1b43a1, d1b43b1

Details for d1b43b2

PDB Entry: 1b43, 2 Å

PDB Description: fen-1 from p. furiosus

SCOP Domain Sequences for d1b43b2:

Sequence; same for both SEQRES and ATOM records:

>d1b43b2 c.53.1.2 (B:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus}
gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
prlvrnltitgkrklpgknvyveikpeliileevlkelk

Timeline for d1b43b2:

• d1b43b2 first appeared (with stable ids) in SCOP 1.55
  
• d1b43b2 appears in SCOP 1.61
  
• d1b43b2 appears in SCOP 1.65
  
• d1b43b2 appears in the current release, SCOPe 2.08