Lineage for d5wx5b2 (5wx5 B:242-395)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918314Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries)
  8. 2918348Domain d5wx5b2: 5wx5 B:242-395 [333615]
    automated match to d3wd7a2
    mutant

Details for d5wx5b2

PDB Entry: 5wx5 (more details), 3.06 Å

PDB Description: alkylquinolone synthase y215v mutant from evodia rutaecarpa
PDB Compounds: (B:) alkylquinolone synthase

SCOPe Domain Sequences for d5wx5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wx5b2 c.95.1.0 (B:242-395) automated matches {Tetradium ruticarpum [TaxId: 354523]}
lfqvvscaeravpgtqdyikahlkemgmelhlstdvprmigknieklladavspfgisdw
nslfyivhpgavaildqveenlglgedklrasryvlseygnmgaasvffildemrnksae
egklttgeglewgvlfsfgpgltvetvvllsvpl

SCOPe Domain Coordinates for d5wx5b2:

Click to download the PDB-style file with coordinates for d5wx5b2.
(The format of our PDB-style files is described here.)

Timeline for d5wx5b2: