![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.53: Resolvase-like [53040] (2 superfamilies) |
![]() | Superfamily c.53.1: Resolvase-like [53041] (2 families) ![]() |
![]() | Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins) |
![]() | Protein Flap endonuclease-1 [53052] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries) |
![]() | Domain d1a76_2: 1a76 2-208 [33361] Other proteins in same PDB: d1a76_1 |
PDB Entry: 1a76 (more details), 2 Å
SCOP Domain Sequences for d1a76_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a76_2 c.53.1.2 (2-208) Flap endonuclease-1 {Methanococcus jannaschii} gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga prvvrnltttkempelielnevledlr
Timeline for d1a76_2: