Lineage for d5wroa2 (5wro A:208-500)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445370Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2445478Protein automated matches [226973] (8 species)
    not a true protein
  7. 2445508Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [333608] (1 PDB entry)
  8. 2445509Domain d5wroa2: 5wro A:208-500 [333609]
    Other proteins in same PDB: d5wroa1, d5wroa3
    automated match to d2xsxa2
    complexed with cd, cl, co, gol, so4

Details for d5wroa2

PDB Entry: 5wro (more details), 2.02 Å

PDB Description: crystal structure of drosophila enolase
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d5wroa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wroa2 c.1.11.1 (A:208-500) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
keiilpvpafnvinggshagnklamqefmilptgatsfteamkmgsevyhhlknvikakf
gldatavgdeggfapniqsnkealnlisdaiakagytgkieigmdvaasefykdgqydld
fkneksdksqwlpadklanlyqefikdfpivsiedpfdqdhweawsnltgctdiqivgdd
ltvtnpkriatavekkacnclllkvnqigtvtesiaahllakkngwgtmvshrsgeteds
figdlvvglstgqiktgapcrserlakynqilrieeeigagvkfagksfrkpq

SCOPe Domain Coordinates for d5wroa2:

Click to download the PDB-style file with coordinates for d5wroa2.
(The format of our PDB-style files is described here.)

Timeline for d5wroa2: