Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [333555] (1 PDB entry) |
Domain d5vgma1: 5vgm A:1-342 [333585] Other proteins in same PDB: d5vgma2, d5vgmb2 automated match to d4lfyb_ complexed with act, cl, zn |
PDB Entry: 5vgm (more details), 1.95 Å
SCOPe Domain Sequences for d5vgma1:
Sequence, based on SEQRES records: (download)
>d5vgma1 c.1.9.0 (A:1-342) automated matches {Vibrio cholerae [TaxId: 666]} mttltitrpddwhvhlrdgdvladtvrdisryngralimpntvppvtttemalayrerim aaqpqahfeplmalyltdntspeeirkakasgkvvaaklypagattnsdsgvtsakniyp vlqamqevgmlllvhgevtthevdifdrektfldtvlapivndfpqlkivlehittadav tfvqqagdnvaatitahhllfnrnhmlvggirphfyclpilkrathqhalvaaatsgskk fflgtdsaphakgrkeaacgcagsytahaalelyaevfekegklenleafasfngpdfyg lprnqetvtltkqawpvaesmpfgsdivvpirageniewtvk
>d5vgma1 c.1.9.0 (A:1-342) automated matches {Vibrio cholerae [TaxId: 666]} mttltitrpddwhvhlrdgdvladtvrdisryngralimpntvppvtttemalayrerim aaqhfeplmalyltdntspeeirkakasgkvvaaklypgvtsakniypvlqamqevgmll lvhgevtthevdifdrektfldtvlapivndfpqlkivlehittadavtfvqqagdnvaa titahhllfnrnhmlvggirphfyclpilkrathqhalvaaatsgskkfflgtdsaphak grkeaacgcagsytahaalelyaevfekegklenleafasfngpdfyglprnqetvtltk qawpvaesmpfgsdivvpirageniewtvk
Timeline for d5vgma1: