Lineage for d5lajr_ (5laj R:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996284Domain d5lajr_: 5laj R: [333540]
    Other proteins in same PDB: d5laja_, d5lajb_, d5lajc2, d5lajf_, d5lajg_, d5lajh_, d5laji_, d5lajj_, d5lajk_, d5lajl_, d5lajm_, d5lajn_, d5lajo_, d5lajp_, d5lajq2, d5lajt_, d5laju_, d5lajv_, d5lajw_, d5lajx_, d5lajy_, d5lajz_
    automated match to d1iruf_
    complexed with mg

Details for d5lajr_

PDB Entry: 5laj (more details), 2.9 Å

PDB Description: ligand-induced lys33-thr1 crosslinking at the yeast proteasomal subunit beta5 by sulfonate esters
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5lajr_:

Sequence, based on SEQRES records: (download)

>d5lajr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5lajr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5lajr_:

Click to download the PDB-style file with coordinates for d5lajr_.
(The format of our PDB-style files is described here.)

Timeline for d5lajr_: