Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species) |
Species Thermus aquaticus [TaxId:271] [53049] (3 PDB entries) |
Domain d1bgxt2: 1bgx T:1-173 [33353] Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt3, d1bgxt4 protein/DNA complex |
PDB Entry: 1bgx (more details), 2.3 Å
SCOPe Domain Sequences for d1bgxt2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxt2 c.120.1.2 (T:1-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} mrgmlplfepkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgd avivvfdakapsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeadd vlaslakkaekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg
Timeline for d1bgxt2:
View in 3D Domains from other chains: (mouse over for more information) d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2 |