Lineage for d5u0lb_ (5u0l B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2290208Species Marinobacter hydrocarbonoclasticus [TaxId:351348] [333509] (2 PDB entries)
  8. 2290219Domain d5u0lb_: 5u0l B: [333520]
    automated match to d4knab_
    complexed with 8yp, cl, edo, mpd, po4

Details for d5u0lb_

PDB Entry: 5u0l (more details), 2.29 Å

PDB Description: x-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate
PDB Compounds: (B:) N-succinylglutamate 5-semialdehyde dehydrogenase

SCOPe Domain Sequences for d5u0lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u0lb_ c.82.1.0 (B:) automated matches {Marinobacter hydrocarbonoclasticus [TaxId: 351348]}
ltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearkaflawrrksl
aerqavieafgelleankeelahqigletgkplwesrtevaammgkipisvkaynertgh
tesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkpseltpgvae
ltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllheqfggqpek
ilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgkkgdeflarl
vevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemkqlkpdtgll
spgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsddrklynrlv
eevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasleagkselpds
lapglnf

SCOPe Domain Coordinates for d5u0lb_:

Click to download the PDB-style file with coordinates for d5u0lb_.
(The format of our PDB-style files is described here.)

Timeline for d5u0lb_:

  • d5u0lb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-27