Lineage for d1taq_2 (1taq 10-173)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24949Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 24950Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
  5. 24960Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins)
  6. 24961Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 24962Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)
  8. 24965Domain d1taq_2: 1taq 10-173 [33352]
    Other proteins in same PDB: d1taq_1, d1taq_3, d1taq_4

Details for d1taq_2

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase

SCOP Domain Sequences for d1taq_2:

Sequence, based on SEQRES records: (download)

>d1taq_2 c.53.1.2 (10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Sequence, based on observed residues (ATOM records): (download)

>d1taq_2 c.53.1.2 (10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg

SCOP Domain Coordinates for d1taq_2:

Click to download the PDB-style file with coordinates for d1taq_2.
(The format of our PDB-style files is described here.)

Timeline for d1taq_2: