Lineage for d5t8ja_ (5t8j A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013242Domain d5t8ja_: 5t8j A: [333515]
    automated match to d1xj7a_
    complexed with 77t, gol

Details for d5t8ja_

PDB Entry: 5t8j (more details), 2.7 Å

PDB Description: synthesis and biological evaluation of novel selective androgen receptor modulators (sarms). part ii: optimization of 4-(pyrrolidin- 1-yl)benzonitrile derivatives
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d5t8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8ja_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfhtq

SCOPe Domain Coordinates for d5t8ja_:

Click to download the PDB-style file with coordinates for d5t8ja_.
(The format of our PDB-style files is described here.)

Timeline for d5t8ja_: