SCOPe 2.08: Domain d1tfra2: 1tfr A:12-180

Lineage for d1tfra2 (1tfr A:12-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein T4 RNase H [53046] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries)

8. Domain d1tfra2: 1tfr A:12-180 [33351]
   Other proteins in same PDB: d1tfra1
   complexed with mg

Details for d1tfra2

PDB Entry: 1tfr, 2.06 Å

PDB Description: rnase h from bacteriophage t4

PDB Compounds: (A:) t4 RNAse h

SCOPe Domain Sequences for d1tfra2:

Sequence, based on SEQRES records:

>d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkyea
ddhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Sequence, based on observed residues (ATOM records):

>d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeaddhiavlvk
kfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Timeline for d1tfra2:

• d1tfra2 first appeared (with stable ids) in SCOP 1.55, called d1tfr_2
  
• d1tfra2 appears in SCOPe 2.07