SCOPe 2.06: Domain d5jhga1: 5jhg A:714-941

Lineage for d5jhga1 (5jhg A:714-941)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries)
   Uniprot O15085 714-1081

8. Domain d5jhga1: 5jhg A:714-941 [333433]
   Other proteins in same PDB: d5jhga2, d5jhgb_, d5jhge2, d5jhgf_
   automated match to d1xcga1
   complexed with gol

Details for d5jhga1

PDB Entry: 5jhg, 2.5 Å

PDB Description: crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d5jhga1:

Sequence; same for both SEQRES and ATOM records:

>d5jhga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld

Timeline for d5jhga1:

• d5jhga1 is new in SCOPe 2.06-stable
  
• d5jhga1 appears in SCOPe 2.07
  
• d5jhga1 appears in the current release, SCOPe 2.08